β-CGRP (human)
H-Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ (Disulfide bond)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-743 | 0.5mg | 270.00 | + Add to cart |
|
R-M-743 | 1mg | 410.00 | + Add to cart |
|
|
Product description
β-CGRP (human),CAS : 101462-82-2 from ruixi.It is a synthetic peptide.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 101462-82-2 |
Sequence | ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂ |
Synonyms | Calcitonin Gene Related Peptide II, human, CGRP-II (human) |
Molecular Formula | C₁₆₂H₂₆₇N₅₁O₄₈S₃ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product